SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013411 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013411
Domain Number 1 Region: 190-465
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.35e-79
Family Mitochondrial carrier 0.0000384
Further Details:      
 
Domain Number 2 Region: 29-127
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000945
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013411   Gene: ENSPFOG00000013351   Transcript: ENSPFOT00000013429
Sequence length 474
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519630.1:2285581:2293787:1 gene:ENSPFOG00000013351 transcript:ENSPFOT00000013429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLCLYVPVSNSDPVEVEYFESNGLPSELKSLFNKLSVFLPSQEFSTYQKWRKKTLKSE
EKDADGQLDFEEFVHYMQDYEKDLKLVVKSLDRKNAGRIDAKELMQSLRDLGVHISLQHA
ETVLKRHTPLETRGAHNTKISLFHNHQRAENTQNAPENTLHEKHHTIFDVGENLMVPDEF
TMEEKQTGMWWRHLAAGGGAGAVSRTCTAPLDRLKVMMQVYGSRTNNMCIMSGLMQMIKE
GGTRSLWRGNGVNVIKIAPESALKFMAYEQIKRLIGSDKETLSILERFVAGSLAGVIAQS
TIYPMEVLKTRLALRTTGQYAGISDCAKQIFRKEGLGAFYKGYVPNMLGIIPYAGIDLAV
YETLKNGYLQQYGANSTDPGILVLLACGTVSSTCGQLASYPLALVRTRMQAQAVTEGNHQ
QASMTGVFRQILQNEGPAGLYRGLAPNFLKVIPAVSISYVVYEHLKTQLGVTSR
Download sequence
Identical sequences A0A087Y5V8
ENSPFOP00000013411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]