SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014288 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014288
Domain Number 1 Region: 610-763
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-46
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 320-388
Classification Level Classification E-value
Superfamily RING/U-box 2.16e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 2-65
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000511
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 4 Region: 404-462
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000305
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 5 Region: 81-141
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000962
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014288   Gene: ENSPFOG00000014272   Transcript: ENSPFOT00000014308
Sequence length 763
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519630.1:2664776:2683646:-1 gene:ENSPFOG00000014272 transcript:ENSPFOT00000014308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLSCHVCSETFRDPVSLSCNHSFCSSCLEEFWEQTGNKNCPICKRSSKEHPSINFSLKE
LADVFGEKQKGASTEMEREKKKEKVVCEKHSEVPYWFCEDEQRAVCPVCEFSLHQSHKVV
PIEEAVSELKEQLKSDLKSLQDKRNKHKQVEKTYDDVIQHSKEQVSSTERQIRAEFNKLH
QFLRKEEESRLAALREEEEQKRKTIIREMKRIEEQISSLSDSISAVEEELQKDNVSFLSS
YEATQRSEQVRRIMDDLNILMESNVNYVLKTYLKNTIVYKCCFDRCLNMVSSNKKKKRVT
SLVSRAVEVIQSKMAERALLESYLSCHVCSETFRDPVSLSCNHSFCSSCLEEFWEQTGNK
NCPICKRRSSKDYPVVNFTLKELADSFTGRQKSGSSERNKGAKQLMVCSKHQEDPKLFCE
DEQRAVCPVCEFSLHQSHKVVPVEEAVSDLKEQLESDLKSLQDKRNKHEQVEKTYDDVIQ
HSKKQVLSTERQIRAEFNKLHQFLREEEESRLAALREEEEQKRKTIMGEMKRIEQQISSL
SDSISAVEEELQKDSVSFLSSYEATQSRARGQRSLPDPQLVSGALIDVAKHLGNLSFRVW
EKMKDQVKFSPVILDPNTANGWIHLSDDLTSLRRGDTDQQLPDNPERNTKYKNVFGSEGF
NSGKHSWEVEVGDYPRWTVGLVKESVDRKGERHGLPDYGIWRLCHGDRKYSDVAGKTLKL
KKSLQRIRVQLDYDMGVVSFYDCEDMTLICTHRDTFTEKLFPY
Download sequence
Identical sequences ENSPFOP00000014288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]