SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014324 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014324
Domain Number 1 Region: 140-432
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-87
Family Nuclear receptor ligand-binding domain 0.0000000222
Further Details:      
 
Domain Number 2 Region: 37-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-29
Family Nuclear receptor 0.00000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014324   Gene: ENSPFOG00000014233   Transcript: ENSPFOT00000014344
Sequence length 437
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520074.1:341839:379723:1 gene:ENSPFOG00000014233 transcript:ENSPFOT00000014344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTPNQRHLSFLSLRSVMEPMTVTTSVVGPDEFDRNAPRICGVCGDKATGFHFNAMTCEGC
KGFFRRSMKRKASFTCPFNGSCTITKDNRRHCQACRLKRCIDIGMMKEFILTDEEVQRKR
EMIMKRKEEEAAREAQRPRLNEEQARMISSLVEAHHKTYDASYSDFSRFRPPVRDGPVTR
SASRAASLHSLSDASSDSFNHSPAESVDTKMNFSNLLMMYQDGASSPDSCEEDTKLSMLP
HLADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSC
GGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQD
HARIEQLQDRLSEALQAYIRVNHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEH
SLQLTPLVLEVFGSEVS
Download sequence
Identical sequences ENSPFOP00000014324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]