SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000014968 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000014968
Domain Number 1 Region: 366-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-47
Family SPRY domain 0.00055
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 8.72e-21
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-17
Family B-box zinc-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000014968   Gene: ENSPFOG00000014932   Transcript: ENSPFOT00000014990
Sequence length 521
Comment pep:novel scaffold:PoeFor_5.1.2:KI519951.1:148385:150001:1 gene:ENSPFOG00000014932 transcript:ENSPFOT00000014990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEMEQNQLDRETFSCSICLDLLKDPVMIPCGHSYCMNCITSFWDEGERKKSYHCPQCRKT
FSSRPELQKNIMLAALVEQLNKTGLQAAAADHRYAGPEDVACDVCSGRKLKAIKSCLVCL
ASYCEKHLQPHYDSAPFRKHKLVEPSKNLQENICSKHDEVMKMFCRTDQKCICYLCSVDE
HKGHDTVSAAAERTERQRELEERRGKIQQMIQNQEKDVKLLQQEVEAINHSAEKTVEDSE
KVFTQLIRLLQKRSSEVKQQIRSQQETEVSRVKELQEKLEQEITELKRKDAELEQLSHTE
DHNQFLLNYPSLPALRESTHSSSINIRPLRHFEDVTAAVSELREKLQDVLRDSWTNISLM
VTRCSCEITLDPNTAHPQLVLSEGNKKAIVTAQHQSYSNHPDRFTYFAQVVSRESLTGRC
YWEVEWSRAWIHVAVAYKNISRAGRGKVCRFGDNDKSWALLCHQNSFKFGHNDIWTSISG
PAFSRLGVYLDHTAGILSFYSISETMTLLHRVQTTFTQPLL
Download sequence
Identical sequences A0A087YAB5
ENSPFOP00000014968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]