SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015115 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015115
Domain Number 1 Region: 353-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-53
Family SPRY domain 0.0000397
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 2.26e-16
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 138-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000183
Family B-box zinc-binding domain 0.00096
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000015115
Domain Number - Region: 185-287
Classification Level Classification E-value
Superfamily Prefoldin 0.00392
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015115   Gene: ENSPFOG00000015085   Transcript: ENSPFOT00000015137
Sequence length 549
Comment pep:novel scaffold:PoeFor_5.1.2:KI519951.1:373548:384621:-1 gene:ENSPFOG00000015085 transcript:ENSPFOT00000015137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATAKSVKDDCFLERHLKCPICMETFTDPVTTSCGHSFCMRCLELSIASFQVDYACPLC
KKHLRKAPKVNNVLRDIVQEVKNTLSQTFTGAAGEVPCDACTVPKKKAEKSCLVCVASFC
STHLENHYSAKRLKGHKLVEPVENLDTRACPTHGCPLALYCRKRQTCICARCLDGDHGKV
VSAEEEWQEKKDQIENTKAQLQERIMTRKAKIDEINEALKSCKEDVGKEWWDIDALFTAV
LDVVKAAKGEALNPLEDKLQLLNKESKNLKDELEDEINKLEATISKLDDISALEDHILFL
QMYPSLSVQDVMKDWTYIELDTTLSFGSMRETATTMIENIQQQLEKLATIELARFTKFEV
DVRLDPDTAHQRLVVSDDRSKVRDEGENQEVADSPKRYDVLGSVLGLNTLATGKSYWEVE
VGSTNGWDLGVARGSANRRGRPALNPDNGYWVLVHFEESDVPKPFTAYAVMTAPPVSLSF
KDQPKKVGVFVDYEEGIVSFYDVTARSHIYSFSKCSFQDELHPFFSLHMKNEINFEPLII
SKINHTKMN
Download sequence
Identical sequences A0A087YAR2
ENSPFOP00000015115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]