SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015117 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015117
Domain Number 1 Region: 355-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-26
Family SPRY domain 0.00082
Further Details:      
 
Domain Number 2 Region: 10-74
Classification Level Classification E-value
Superfamily RING/U-box 2.16e-17
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 138-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000946
Family B-box zinc-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015117   Gene: ENSPFOG00000015088   Transcript: ENSPFOT00000015139
Sequence length 537
Comment pep:novel scaffold:PoeFor_5.1.2:KI519951.1:392975:397802:-1 gene:ENSPFOG00000015088 transcript:ENSPFOT00000015139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTHSILTSLPEEHFRCLLCLDLFTEPVTTPCGHNFCRTCLSQQWSDGDCYQCPKCNKRF
PVKPEFSTNEVMAEMSVQLKRRKIEALESENAPWQVKCDVCADFRLKASKSCLVCLASYC
DGHLEPHRRVPALMRHKLVEPLENLEERVCEKHTRILEFFCRREQAFVCLLCCEAEHRDH
ETVPVEEEGALQKETIDSQQTKIKLMIDERMEKIEEFQKTSEMSKVKGDNIIECGEKLFS
NLMSRVKEIQSTLLSNIEREMRKSKENVQVMIQELEEEVAALEMKHSQLEELSQNEDNLR
LLQTLQTLNTMSKTKDWSKTKVYPDLYVHTMRTAVENLVNGFQITLRTLTNIELTKMREY
KESVTFDESTAGAGLVITDSGKRLKYAKTATPSPTPSSKSQRFCLPMVFGTNGFISGRHY
WEVEVGLRNDWHVGVALETVDRSQSTVNKDRGFYFLGKSGFDYEVRDTACKVLHLSPRPR
SVGVYLDYEAAAQRGQSLCSYFPSLIQNTTFVSFALLTKLKNQLNRIDCRVKLQLDP
Download sequence
Identical sequences A0A087YAR4
ENSPFOP00000015117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]