SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015147 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015147
Domain Number 1 Region: 14-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-29
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 136-317
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000329
Family Pentraxin (pentaxin) 0.02
Further Details:      
 
Domain Number 3 Region: 813-1111
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000403
Family Rhodopsin-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000015147
Domain Number - Region: 490-550
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0471
Family Hormone receptor domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015147   Gene: ENSPFOG00000015010   Transcript: ENSPFOT00000015169
Sequence length 1213
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519778.1:963899:1018134:1 gene:ENSPFOG00000015010 transcript:ENSPFOT00000015169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLHRTVLGCSSINCNVVLTEAQGDFTSPCYPQKYPNSHTCKWTMQAPTGFIIQLSFLDF
ELEEAQDCMYDRVVVNTGSTESKFCGLTARGLTLNSTRNVMEVSFISDFSIQKKGFTVSF
QHVAVALRNQKVKIPNGNGQIAEVINSVSIPALNELTICFEVERTGSRQNCTNKEWLFTY
YDINNNVALSFGYNQTGMEMVIDGVVCPVESIISVAEFTSSMKFFCVLWMSSNSRVAVYF
NRRYYGKSCSPSSGHSVPAGGVFKLGGLGVQSFKGNMYNLRLWNRAMTVQELSGLTCDMV
GNVIDWDNSQWTISSSLAQTDNTLSCIDYYLLRYSLICPPACSGKGSQVCQKILKWTTLQ
LPFLTTNHPSTNKADVSSLDGLFYRVSFTVESKLSQQEVQRATALWINQTFQNWTHSLDY
ISFTCQVLLMITNESLGEADVLDQLNNNPAGTSLLGQAANINVRQIGQERVQPQRSVQLE
TLSLDICKNCPEDNNLHYLWPETKPRVTHFLPCFPNKDQSASRTCLINPETFQSVWSTAN
LTNCSVTAENAAGVAEQLANFTKNTLSTEEVSQVVTKVQELVSVAKIDTAVAESVVHIIS
NVMVSSEKASNIALKAVDELAKKVEFDGASVHINSKNLALGVLALDSRSFNGTSFSAFFP
PNSTDPQIEFDRTANPLAQVTLPASLLSGVSADVFSRSSLSRINFMFFSSPSLFMKEQKG
LSLNSYVVASSVGNISITDLQDPVKIEIAHLSDQGSSRRKCVFWDFSMNRGDGGWNNRGC
SVSKESTSSRTICLCNHLTHFGILMDISQTSFIIDPENKKVLTFLSYIGCGISAICSAAT
LLTYIAFEKLRRDYPSKILMNLSTSLLFLNIVFLLDGWLASMVYSEGLCISAAVLLHYFL
LTSFTWMGLESVHMYIALVKVFNTYIRRYILKFCIVGWGLPAVLVGIVVTANKDYYGVLN
NHTDDSAMMFPLRCWIKEKSVFYTTCVGYFCLMFLLNVAMFIVVMMQICGRNGKRSNRTL
REEILRNLRSVVSLTFLLGMTWGFALFAWGPVYLTFTYLFTIFNSLQGLFIFIFHCALKE
NVQKQWRRYLCCGPYRLSENSDWSKTATNNTKKVSSDNLAKSLSSSSFGSSTINWTSKAK
ATLTPFSKRNRNTARNIFISTPQQMFLQPDQPQVCLLIVSQMIDKVRDYCSTRTDNFYKN
IIMSDSFANCTRL
Download sequence
Identical sequences A0A087YAU4
ENSPFOP00000015147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]