SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015247 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015247
Domain Number 1 Region: 8-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-29
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 130-307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-16
Family Pentraxin (pentaxin) 0.016
Further Details:      
 
Domain Number 3 Region: 808-1102
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000033
Family Rhodopsin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015247   Gene: ENSPFOG00000015121   Transcript: ENSPFOT00000015269
Sequence length 1205
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519778.1:1051592:1093527:1 gene:ENSPFOG00000015121 transcript:ENSPFOT00000015269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGCSSINCNVVLTEAQGDFTSPCYPQKYPNSHTCKWTMQAPTGFIIQLSFLDFELEEAQ
DCMYDRVVVNTGSTESKFCGLTARGLTLNSTRNVMEVSFISDFSIQKKGFTVSFQHVAVA
LRNQKVKIPNGNGQIAEVINSVSIPALNELTICFEVERTGSRQKEWLFTYYDINNNVALS
FGYNQTGMEMVIDGVVCPVESIISVAEFTSSMKFFCVLWMSSNSRVAVYFNRRYYGKSCS
PSSGHSVPAGGVFKLGGLGVQSFKGNMYNLRLWNRAMTVQELSSLTCDMVGNVIDWDNSQ
WTISSSLAQTDNTLSCKTGAQYLRLPNASLLLCSFLTFFCTSASINTTTTSPPSTTAPIA
STSSTHGFFADGLFYRVSFTVESELSQQEVQRATALWINQTFQNWTHSLDYISGRSLKLQ
LNVKRMNNYRTISSELSFSFTCQVLLMITNESLGEADVLDQLNNNPAGTSLLGQAANINV
RQIENCPEDNNLHYLWPETKPRVTHFLPCFPNKDQSASRTCLINPETFQSVWSTANLTNC
SVTAENAAGVAEQLANFTKNTLSTEEVSQVVTKVQELVSVAKIDTAVAESVVHIISNVMV
SSEKASNIALKAVDELAKKVEFDGASVHINSKNLALGVLALDSRSFNGTSFSAFFPPNST
DPQIEFDRTANPLAQVTLPASLLSGVSADVFSRSSLSRINFMFFSSPSLFMKEQKGLSLN
SYVVASSVGNISITDLQDPVKIEIAHLSDQVHLKKCVFWDFSMNRGDGGWNNRGCSVSKE
STSSRTICLCNHLTHFGILMDISQTSFIIDPENKKVLTFLSYIGCGISAICSAATLLTYI
AFEKLRRDYPSKILMNLSTSLLFLNIVFLLDGWLASMVYSEGLCISAAVLLHYFLLTSFT
WMGLESVHMYIALVKVFNTYIRRYILKFCIVGWGLPAVLVGIVVTANKDYYGVLNNHTDD
SAMMCWIKEKSVFYTTCVGYFCLMFLLNVAMFIVVMMQICGRNGKRSNRTLREEILRNLR
SVVSLTFLLGMTWGFALFAWGPVYLTFTYLFTIFNSLQGLFIFIFHCALKENVQKQWRRY
LCCGPYRLSENSDWSKTATNNTKKVSSDNLAKSLSSSSFGSSTINWTSKAKATLTPFSKR
NRNTVNFANDKLVCSLYHARISGKITAVVPFSQMIDKVRDYCSTRTDNFYKNIIMSDSFA
NCTRL
Download sequence
Identical sequences ENSPFOP00000015247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]