SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015267 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015267
Domain Number 1 Region: 358-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-63
Family SPRY domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-20
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 143-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-16
Family B-box zinc-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015267   Gene: ENSPFOG00000015098   Transcript: ENSPFOT00000015289
Sequence length 546
Comment pep:novel scaffold:PoeFor_5.1.2:KI519951.1:402134:409526:-1 gene:ENSPFOG00000015098 transcript:ENSPFOT00000015289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATGNLSEEQVHCSICLDVFTNPVSIPCGHNFCQTCILGYWKTSPLYQCPMCKKSFHKR
PDISVNTVLREIAEQFKQELKQKQEEKKKKQEVKESQVWEEVLCDVCLGEGRPKAVKSCL
VCLTSYCDEHLKSHSTRFTKHKLMEPVANMEDRMCPKHERLLELFCKKDQTCVCVLCTET
DHRAHYTVPVEREWTEKKALLKKTEIDVQQMIQDRVKKVEEIKHSVELNKVSAQREIEES
MQVFSELVRSIQKAQAELVLVIEEKQRQTERRAEGLIAELEQEISELKTRHTDLENVNRT
DHIHFLKSFPALSATPSVKDWSETSIPTDTCVGMIRRSVSKLETTLSEMIDKLSANEIKK
ILKYSVDITLDPDTANPWLQLSQDRHQVRHLGAWQELPDHPDRFDTVVIVLGRDGFTSGR
HYWEVQVGDKDDWYLGVAKSSVKRKGRISVSTAQGYWALAMKKGQGYRVSTSPPLLLSLD
QKPKRVGVYVDYEEGQISFYDVRTRIHIYTFEDAFTERILPFFYLYCCDKASDTMDICPV
QEKSLI
Download sequence
Identical sequences ENSPFOP00000015267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]