SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015281 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015281
Domain Number 1 Region: 382-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-55
Family SPRY domain 0.0000274
Further Details:      
 
Domain Number 2 Region: 13-80
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-20
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 166-231
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000229
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015281   Gene: ENSPFOG00000015240   Transcript: ENSPFOT00000015303
Sequence length 568
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519951.1:412259:424360:-1 gene:ENSPFOG00000015240 transcript:ENSPFOT00000015303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSINSPSGRALTEDQFTCSICLEIFVEPVSTPCGHSFCKACLQGYWNHSKKFLCPMCKKS
YSRRPEMSVNRVLAEISSQFQGLVVSGGASGSPSRGGSMTMSSDSGHSSSPAQDTGEFAQ
PGDVPCDACIGRKLKALKSCVNCPGSYCEAHLRHHKKVKTLTSHCLIEPTFHLEEKICKK
HERLLEVYCCTDHTCICKSCAEATHKSHDIISVDQEFKKKMTNLGKKRSVLKNLIKERAK
KLEEIKQSIKVIKASSQKELEDSWQVYGALQKLVEQSQAEMVELITAREREAERHAQEQA
RSLENELSQLRRRSNELEAHAHTKDKVVFLQNLATLSHSPEYTDWSGVSINTDIYLGTLR
SSVSGLIEKFQDELKKLYAKEFRKVQNYASEVVLDPSTAQKNLVVTHEGQQVKYEEHKVS
HSEGPKRFNPALFVLGRESIHSGRHYWEVEVGRKTAWTLGVARATARRKGEIKLNPEGGY
WCLWLKNGEVKALAETRLPLALMSHPSKVGLFLDYEAGQLSFYDVKARQHLYTFMDKFNE
SVYPIFSPCLSQDGKNNSPLIITQVKHT
Download sequence
Identical sequences A0A087YB78
ENSPFOP00000015281 XP_007574036.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]