SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015295 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015295
Domain Number 1 Region: 34-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000587
Family V set domains (antibody variable domain-like) 0.041
Further Details:      
 
Domain Number 2 Region: 135-192,260-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000021
Family I set domains 0.074
Further Details:      
 
Domain Number 3 Region: 336-419
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000104
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015295   Gene: ENSPFOG00000015233   Transcript: ENSPFOT00000015317
Sequence length 477
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519644.1:2134357:2139779:1 gene:ENSPFOG00000015233 transcript:ENSPFOT00000015317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHFIKQKCPKMKNLLQFFVCLIVALETNGADKVIYRRVGDDVKLDFSHLPTNYYVRWFFE
KEDGLELADTTYLGRKQVNPDSGEIWTRRLTISPNSLTINNMQEENFGTIICIVKDGSTS
RDTLKFHLIKVTVSIKEQLPVIPGHSLSLNCDAETRRQHSIYWLKPTGRKATPILGSVTK
TAESQDNGEWKCVVKDNGEESSFSFKFLVSVVVSDFSSASKYVYTSTNLPLSLPFRITPK
EFVQKIPSEVETVEWLFTPKTSSSQHTIFSFSPKNGQLKQKDPARELSYKNFTADGSFSL
YKNLAKVEDRGTYNCSITFKNGYMVSRTLVVEVVEITPSPGTELISGHHLNLSCSTGGPL
ETGVMVKWVPPETSSLAKANLSSGHLIIPRVATVDSGKWRCDLRWSTTTLTSAVITLKID
PILSVWMIVTICAAGVSLILLLVLAFILFRRRQHKMRQLRHRLCKCKNPKPKGFYKA
Download sequence
Identical sequences ENSPFOP00000015295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]