SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015700 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015700
Domain Number 1 Region: 378-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-48
Family SPRY domain 0.00041
Further Details:      
 
Domain Number 2 Region: 11-83
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-20
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 3 Region: 143-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-16
Family B-box zinc-binding domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000015700
Domain Number - Region: 195-310
Classification Level Classification E-value
Superfamily t-snare proteins 0.0322
Family t-snare proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015700   Gene: ENSPFOG00000015648   Transcript: ENSPFOT00000015722
Sequence length 554
Comment pep:novel scaffold:PoeFor_5.1.2:KI519655.1:2976045:2982728:1 gene:ENSPFOG00000015648 transcript:ENSPFOT00000015722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARMEHNQLDQETLCCSICLDLLKDPVTIPCGHSYCMNCIKTHWDEEDEKRIHSCPQCKE
TFTPRPVLKKNTMLAALVEQMKKTGLQAAAADHRYAGPEDVACDFCTGRKLKAIKSCLFC
LASFCEKHLQPHYDSAAFKKHKLVEPSKNLQENICSKHDEVMKMFCRTDQKFICYLCSVD
EHKDHDTVTVAAEIAERQRGLEEKQQKIQQMIQDREEDVKLLQQEVEAINRSADKAVEDS
EKIITELICLLQKRSSDVKQQIRSQQETEVSRFKEMEXKLEQEITELKRKDAELEQLSHT
EDHNQFLLNYPSLPAPSESTHSSSVNIRPLRHFEDVTAAVSELRDKLQDVLRDSWTNISL
MVTEVDVLLAEPEPKSRDGFLRYSCEITLDPNTAQTRLKLSEGNRKVRLMGQSQSYPSHP
DRFTGYYQVLSRESLTGRCYWEVEWSGLVNVAVAYKNICREGRENECFFGNNNKSWALNC
NGSSFGHNNIWTFISGPVSSRVGVYLDHRAGILSFYSVSESMTLIHRVQTRFTQPLLAGL
YVYNGGGSAEFCNP
Download sequence
Identical sequences ENSPFOP00000015700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]