SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015736 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015736
Domain Number 1 Region: 620-752
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-22
Family SPRY domain 0.0036
Further Details:      
 
Domain Number 2 Region: 325-392
Classification Level Classification E-value
Superfamily RING/U-box 1.75e-18
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 2-69
Classification Level Classification E-value
Superfamily RING/U-box 5.2e-18
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 79-134
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000611
Family B-box zinc-binding domain 0.00087
Further Details:      
 
Domain Number 5 Region: 408-459
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015736   Gene: ENSPFOG00000015692   Transcript: ENSPFOT00000015758
Sequence length 761
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519855.1:143339:149812:1 gene:ENSPFOG00000015692 transcript:ENSPFOT00000015758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSEDLTCSVCLIIFTDPVTLFCGHSFCRECITLSLKSLNQCPQCRATVPTDMMDFTTNHI
LKSLAEKAKKALLTLKAAVGFCPEHDEKLKLFCVTDQQLTCIICRDCERHEGHKFKPVKE
AAASIRKEVETLVEKETSDICAIEHLVESQNEEIRKSEEKSQQLRIQISSQFQEMHQFLK
RREDEILNELKDKEKDELEKMRRSLNVVEKALTEGREVGEQMKSVLEVTDPESFLKSWSE
SKMTPKPKSNPKASDLRVVTSSLSLGHYESHLQLFVWKEMRQMIQPQAERLLCLFHEFIF
EAGLSNKITKQAQRKAAAMASVSYSEELTCSVCLTIFTDPVNLPCGHSFCRQCISEVLAT
QQHCPMCGTAVALEAASLPTSLVLKSLAEKAKAKPDEGKRLTAELAALCPEHEEKLKLFC
ITDQQLVCIICRDGEEHEGHQFKPVKEAAASLRKQLEMFEQCTADDIHAVESLADTQKDE
MFKTRERSQQLLTRISKQFEEMHLFLKRRENEIKSELKHKEEDNVEKMKETFQATAVALS
ESRELKEKVSSVLKITESERFLKSWTEGKGKGALEHLFRPRVNELQVVDSSLSLGPYESH
LQFFMWKEMLQVIKPRAELLTLKSDSQDVVVSDDGRSLFCRPKMHQAVETDFGSVSEFGA
GQHYWEIEVGSRSYWELGVIHNLLKYDGVKYASCGPNVTTELEFRNRPRKIGVYFNCSSK
ELSFYDADTMTHIHSFYACFAEGIPPACALCSQLVFLKLKN
Download sequence
Identical sequences ENSPFOP00000015736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]