SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000015746 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000015746
Domain Number 1 Region: 299-530
Classification Level Classification E-value
Superfamily SIS domain 2.72e-18
Family mono-SIS domain 0.0019
Further Details:      
 
Domain Number 2 Region: 29-174
Classification Level Classification E-value
Superfamily SIS domain 0.00000356
Family mono-SIS domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000015746   Gene: ENSPFOG00000015634   Transcript: ENSPFOT00000015768
Sequence length 606
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519693.1:286514:292939:1 gene:ENSPFOG00000015634 transcript:ENSPFOT00000015768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKMAHIVEREDIQDWESTSADYEPTLPVSEKSNPLTRHIDRAPASSIMKMLQACDAQMF
QEKSQTQYQRLLSEEMVKTLMEVAERVRLILKDPQDSLVVLSGCGTSGRLAFFMASGFNR
ELQRLNYAPVCSYVIAGGDRALFSSQEAPEDDPTLGALCLKKVSEGKKRVLFVGVSCGLS
APFVAGQLDFCLRHPDVYTPVLVGFNPAHQARKEPIPGCTLTFHSVVTRMEELAKTQKAF
LINPALGPEAISGSSRMKGGSATKILLEVVFSASFSTARVGAAILVSNSGILQHMRSYEK
ALDFTYSHSEEIAALMEAAGRSLQCGRQVCYLGWGSLGLLGLIDASECKPTFGADHEDIR
GFVSGGYKELGNNEGDLTLMGPEFSISHDDFLDGVLPRLTDADTVLLLYSHSDDVDEVAK
LARRVREKTSNIHAAYHQTDGDAAAKQDDINKLCSSTVIFTWPQEASKRLQHLVRLLQRE
FSTKLLLNAVSTGAHIFKGKVFKNYMIDLQVTNSKLYRRAARLLQKLSGHSESECEEALL
KAIYQVDKLSEDIATCSLEMNQCLSVSVVQVVPLALVCLLTGCSMKEVESRLEQQPIVRE
AMETCL
Download sequence
Identical sequences ENSPFOP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]