SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016054 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016054
Domain Number 1 Region: 89-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-73
Family Calnexin/calreticulin 0.0000000546
Further Details:      
 
Domain Number 2 Region: 298-438
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.68e-59
Family P-domain of calnexin/calreticulin 0.000000159
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000016054
Domain Number - Region: 441-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00015
Family Calnexin/calreticulin 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016054   Gene: ENSPFOG00000015933   Transcript: ENSPFOT00000016076
Sequence length 615
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519621.1:3917181:3922238:-1 gene:ENSPFOG00000015933 transcript:ENSPFOT00000016076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGGGWVWRLLFLSSLAVAAVVSSDEPSEADVLDRDGDMRLDEEEMQVLMADDEEEEAM
VTDEEQFDEDKDGDEKSETDTNVTFQVTYKTPVATGDVYFAETFDDGSLDRWQPSKTTKE
DADDEIAKYDGKWMVEPLKENKVPGDQGLVLKSRAKHHAIAAMLDKPFVFQDEPLVVQYE
VNFQDGIDCGGAYIKLLSDSGSLSLEQFHDRTPYTIMFGPDKCGEDYKLHFIFRHKNPLN
KDMEEKHAKRADVDLKKFYTDKKTHLYTLVLNPDNSYEMFIDQSSVSRGNLLYDMVPPVN
PPKEIDDPNDSKPDDWDERAKIPDPEAVKPDDWDEDAPAKIEDPDALKPEGWLDDEPEFV
SDPNAEKPEDWDEEMDGEWEAPQVPNPSCETAPGCGEWKRPMINNPQYKGKWKAPLIDNP
NYQGVWKPRKMMNPEYFEDLQPFRMTSFKALGLELWSMTSDIYFDNFIITSHKEVADRWA
SDSWGLKKLVASANEPGIFSQLMMAAEERPWLWIIYVLTVGLPVGLAVLFCWPKKPVDDY
VYRRVDQPQSHTGAGEPAAAQDEGERQESDGQGDNQVGADNKTPERTLEDEQKDGGDVAE
ESHKQAVRKRRVRKD
Download sequence
Identical sequences ENSPFOP00000016054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]