SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016397 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016397
Domain Number 1 Region: 394-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-35
Family SPRY domain 0.00039
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000683
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 135-173
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000519
Family B-box zinc-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016397   Gene: ENSPFOG00000016328   Transcript: ENSPFOT00000016419
Sequence length 566
Comment pep:novel scaffold:PoeFor_5.1.2:KI519659.1:1334116:1339517:1 gene:ENSPFOG00000016328 transcript:ENSPFOT00000016419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTDQTRWEELLRCTVCHDTFKDPRQLPCGHSMCMDCLTKLLDHSTDSPFRCPDCRADF
GQVVELQKSYALASIAEDFRLIKKRRETLAECVYCDCCPETKTAAFKSCLKCEVSLCREH
MKDHLELQAFTGHPLVDPLSDLLERKCPQHRDQVLRYYCCSSRRYVCNMCALESKQLGSA
SDASAVLRRQLTQRHQLKDNQGVFIQQDYMDQYFKTLQQQMNESINAVRTQHESINQASN
FTFIAIKHPSCWRQLAGNIVYFHTLGKKRHIVVSRERRCRALNRAPSFCIIKPLTSMFCF
SPAYHYSVENQTLADALERQQSRVHHIYSSIAGETPPSHTHQTKRHRRNSASAAPHLKNV
SGAYVHSDSVPSSSCTGHMADHPLKRLSEDEGTVTFDLDTASRLLGLSADLRTVERVKAA
LHYPNSDGRFDQAPQVLSAPCFSSGAHVWEVEAEGCWDIAVSYRSVPRRSRDGSSAFGHN
SESWSLSHSGQGELFAFHDGHRTALPGSLPSSRIAVEVNFEEGRIGFSAVGATETLLHEF
KAELTQPVCLGLGLHHVDPPSRASIV
Download sequence
Identical sequences ENSPFOP00000016397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]