SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016551 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016551
Domain Number 1 Region: 488-657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-49
Family SPRY domain 0.00034
Further Details:      
 
Domain Number 2 Region: 14-84
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-17
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 148-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000839
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000016551
Domain Number - Region: 107-137
Classification Level Classification E-value
Superfamily RING/U-box 0.0825
Family RING finger domain, C3HC4 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016551   Gene: ENSPFOG00000016457   Transcript: ENSPFOT00000016573
Sequence length 658
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519621.1:4478935:4487627:-1 gene:ENSPFOG00000016457 transcript:ENSPFOT00000016573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEADDSGFSLMSLEDELTCSICLSTFDCPVTIPCGHNFCQNCLLATWKDSYSCPQCRTL
FATRPELKKNTVLSTVVETFRVRSNKTEGGGGAAAASKPEKKRDVVRCDTCMEAEAAQTC
LTCMASFCEEHLRPHRENPIFRLHQLSPPVGDLMERICTDHHKLMELFCSQHQRPICSLC
LQQVHKGCSFTSPEEQRSKKEVDLREKLVFLDGKLSKNESVISQMRVMQNKLRESAIHRK
SALSAGYQQMRDMMTREEGDALKAIDKEVETGETKIRGLISKFSENVDNIGKAKEEIFCL
LGQSQTLAFLQTSFNLPQAVSYDPYSPRITLDSKKVVQSEAFALTLKNYLTELLKQPVEA
RIPKLIAGERAASASGHSTTSLGQESDPSFPLPNPRLPRSHSPAPQAKPAQKKKPQSKKN
PKAPKNPSLTTETNPGNKKLGKSIENLMEFGVKEKPRGRPAAAENKEVTEISSAEKRSDL
MKYGTVLNFDQRTAHKRIELSENFTKASVSDEHTNYPDCPERFAVCSQVMASKGFSAGRH
YWEVRLSSNNFIGIGLAYSSIDRKGPTSRLGRNSKSWCVEWFNVKLSAWHNSSEAVLVNP
NPKRVGVLLDCEEGRATFYNVADRAYPFHSFSFQFAEAVYPAFWIFSSGSYITLCKLQ
Download sequence
Identical sequences ENSPFOP00000016551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]