SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016968 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016968
Domain Number 1 Region: 247-427
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.52e-34
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.025
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000353
Family WWE domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000016968
Domain Number - Region: 28-90
Classification Level Classification E-value
Superfamily WWE domain 0.000719
Family WWE domain 0.0084
Further Details:      
 
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00199
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016968   Gene: ENSPFOG00000016905   Transcript: ENSPFOT00000016990
Sequence length 435
Comment pep:novel scaffold:PoeFor_5.1.2:KI519679.1:1336696:1338961:1 gene:ENSPFOG00000016905 transcript:ENSPFOT00000016990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFHTKVSPDVCICDNFLLGACDAGVKCKMHHTPYPFHWQLWSIKTHQWIDLSPRAQVLL
ERSYCCAEQSDVTLIDKEKYHVLDFETMELDDLSEYDAVRRLTNSENVETNPHFPSKSKI
YWCEGMNYKEYSADLSALLLKKMSEKELKCSFSIGKQKYEVDFTSMTQTRISTGFQRQIC
CRPAYRSPESMYPYLKTLLAFRTGVQSDLDNCEANAAAANFSVDPLQEFSSWYPPVWLQG
SEEDYLLVDVPAGTQASRSIKKFFHENLPETKVDIISIQQIQNLLHWDKYQRQKTHMQKH
HTEAEGPLERHLFHGTTKVASESICLHGFDPRVAGLNGHSHGFGSYFATNVLMSHEYTEA
NEYDEVGCMFLAKVLVGRVCLGKHNYRRPPNAKVSLYDACVDNKQNPLMFIVFDSCQCYP
YYLIKYKKLSEEINI
Download sequence
Identical sequences ENSPFOP00000016968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]