SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000017496 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000017496
Domain Number 1 Region: 212-279
Classification Level Classification E-value
Superfamily Homeodomain-like 9.84e-20
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 86-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000577
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 57-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000128
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000017496
Domain Number - Region: 147-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0638
Family LIM domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000017496   Gene: ENSPFOG00000017394   Transcript: ENSPFOT00000017518
Sequence length 403
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519615.1:5954363:6018900:1 gene:ENSPFOG00000017394 transcript:ENSPFOT00000017518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNWLRSILSLVSLERLSAGERSETRIMLDGIKIEDHPLRSGQATLGVMLGSECHHRSVC
EGCQRPISDRFLMRVNDSSWHEECLQCTVCQQPLTTSCYFRERKLYCKHDYQQLFATKCS
GCMEKIAPTEFVMRALECVYHLNCFCCCVCDRQLRKGDEFVLKEGQLLCKIDYEREKDLL
SSVSPDDSDSEKSDDEELDIKPEKGIGSQGKGDDGKDPRRPKRPRTILTTQQRRAFKASF
EVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQEQQNSQRLGQEVM
SNRMEGMMNSFTPLAPPQQQLVTMDQNGYSTDPFQQGLTPPQMPGDHMNPYGNDSAFHDI
DSDTSLTSLSDCFMASSEVNSMQARVGNPIDRLYSMQNSYFAS
Download sequence
Identical sequences A0A087YHJ3
ENSPFOP00000017496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]