SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000017886 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000017886
Domain Number 1 Region: 199-365
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.49e-41
Family Dual specificity phosphatase-like 0.0000103
Further Details:      
 
Domain Number 2 Region: 376-511
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-31
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 3 Region: 56-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000785
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000017886   Gene: ENSPFOG00000017763   Transcript: ENSPFOT00000017908
Sequence length 513
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519613.1:4228077:4239911:-1 gene:ENSPFOG00000017763 transcript:ENSPFOT00000017908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMSVYFDPGPDPEVNGNITKMEDAKVEIDDGKEESLEPDTMYQKIRKIITPFVMSFGFRV
FGMILIIVDIVLVIVDFALRHKLGETEGNVIEAVSLTISFFFLGDVLLRVYVEGFKVYFS
SKLNIMDACVVVSTLIVTMVYTFIDVTGASLIPRALTFLRFLRIIILVRIFRLASQKKEL
EKVTRRMISENKRRYQRDGFDLDLTYVTDRVIAMSFPSSGKQAFYRNPIHEVARFLDTKH
EGHYKVYNLCSERGYDPKFFHYRVERIFIDDHNVPTLTDMLRYTESVRNWMSADPKNIIA
IHCKGGKGRTGTMVCTWLIDSDQFESAQDSLDYFGERRTDKSRSSKFQGVETPSQSRYVG
YYEIMKTKYNRNLPPSRSLRIKSIRIHSIAGVGKGDGSDLKVKIIMGKNQIFQCVCTTQE
NCKVFPDAGSNAAVISLENGPLVEGDVKVMFESSAGLPKGYEDVPFYFWFNTSFITENKL
FLSREELDNPHKSKTWNIYKEDFGVTMFFSDSD
Download sequence
Identical sequences ENSPFOP00000017886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]