SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018025 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018025
Domain Number 1 Region: 27-493
Classification Level Classification E-value
Superfamily Sema domain 6.41e-120
Family Sema domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 1335-1464,1659-1848
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.12e-51
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 939-1028
Classification Level Classification E-value
Superfamily E set domains 0.000000000000028
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 4 Region: 1028-1131
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000616
Family Other IPT/TIG domains 0.09
Further Details:      
 
Domain Number 5 Region: 843-941
Classification Level Classification E-value
Superfamily E set domains 0.000000000000101
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 6 Region: 496-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000353
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1129-1221
Classification Level Classification E-value
Superfamily E set domains 0.00000264
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 8 Region: 795-831
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000327
Family Plexin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018025   Gene: ENSPFOG00000017667   Transcript: ENSPFOT00000018047
Sequence length 1878
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520253.1:140999:199039:-1 gene:ENSPFOG00000017667 transcript:ENSPFOT00000018047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVCYIFLFFVSIAPPSPQSGRAEYRAPDASFTHLAVHRRTGEVFVGAVNRVVKLSAALLE
LKSHVTGPVEDNARCYPPPSVRACAHRLESTNNVNKLLLVDYTGSRLVACGSIWQGVCQF
LRLDDLFKLGEPHHRKEHYLSGAKEPDGMAGVVVGKKKPVKGSSRLFIGAAIDGKSEYFP
TLSSRKLVADEENNDMFSLVYQDEFVSSQIKIPSDTLSTYPAFDIYYVYGFSSRTYVYFL
TLQLDTQLTQMEAGGEKFFTSKIVRMCSNDTEFYSYVEFPLGCTKDGVEYRLVQAAYRQK
PGRRLAQALGLGPDDDVLFVVFSQGQKNRSNPPRETVLCLFTLHDINLAMRERISSCYRG
EGHLTLPWLLNKELHCIHTPKQIGDDFCGLVLNQPLGGLRVIEGQPLYEDRTEGMGAVAA
YTYGNDTVVFVGTRSGQLKKIRVDGVPPPAQNALLYETVAVAEGQPILRDMVFSPDHRSI
YLLSHRQVTRLPVESCQQYSSCSDCLGSGDPHCGWCVLFNKCSRKESCDRWEEPQHFNTR
LDQCVFISVSPSNMSVTSPPTQLTIRVQNVPELSGGVTCVFENLTETPGQVQIEGQVVCM
SPSLEELPAQAPPYGGEKRAVQLSLRSTETGLRFISTSVVYYNCSVLGSCTSCVSSSFPC
LWCKFRHICTNNLKDCSFQEGRVSSMEGCPQILPTADILVPAGMVRPITLRARNLPQPQS
GQKNYECVFSIQGKVQRIPAVRFNSSCIQCQNTSYWYEGDEAGDLQVDFSIVWDENFLID
KPTFMKALLYKCEAQRSSCGQCLKAPPVFECGWCVESRKCLLRQHCPSPEQNWMHHGRHN
LRCSHPRITKIDPLTGPREGGTRVAIEGENLGLQVKEITHIQVAGVRCNPVPSLYVSAER
IVCDMAEALLPHSPGGPVELCIGVCSAEYRTLSTQTYSFVSPSFTRIRPLMGPVSGGTRL
TVIGRHLDSGSGVSVFVHKEECLFVKRTNREIVCITPASPTGAGLAPVRLMIDRAEVTNT
EVSYSYSEDPTISGIEPNWTILNGSTLITVTGTNLQTIQEPKVRAKYGGVETSNYCTVVN
NSTMTCLAPGLVYNKPDPPEGALRPDEFGFILDQVSSLLVLNSTPFTHYPNPTFDPLGPA
GILEVKPGSPIILKGKNLIPAAPGNARLNYTVLIGESPCLLTVSENQLLCDSPDLTGEQR
VAIQVGGLEYFPGILHIYSDNTLTLPAIIGIGAGGGVLLIAIIAVLIAYKRKTRDADRTL
KRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEYRTYTMRVMFPGIEE
HPVLKELDSPANVEKALRLFSQLLNNKMFLLSFIHTLEAQRSFSMRDRGNVASLLMAALQ
GRMEYATVVLKQLLADLIEKNLENRNHPKLLLRRTESVAEKMLTNWFTFLLHRFLKECAG
EPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQLTLMCIPPEGEAGTEV
PVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLEWRQGRLTRIILQDEDVTTKIE
SDWKRLNTLAHYQVTDGSLVALVQKQVSAYNIANSFTFTRSLSRYESLLRTSSSPDSLRS
RAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLF
ETVFSTAHRGSALPLAIKYMFDFLDEQADKRSITDPDVRHTWKSNCLPLRFWVNVIKNPQ
FVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYR
DISKMPSISDQDMDAYLVEQSRLHGNEFNTLSALNELYFYINKYKEEILTALDRDGYCRK
HKLRHKLDQAINLMSGSS
Download sequence
Identical sequences ENSPFOP00000018025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]