SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018189 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018189
Domain Number 1 Region: 227-288
Classification Level Classification E-value
Superfamily Homeodomain-like 1.15e-20
Family Homeodomain 0.0035
Further Details:      
 
Domain Number 2 Region: 108-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000178
Family LIM domain 0.0087
Further Details:      
 
Domain Number 3 Region: 76-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000184
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000018189
Domain Number - Region: 168-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.039
Family LIM domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018189   Gene: ENSPFOG00000018085   Transcript: ENSPFOT00000018211
Sequence length 364
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519708.1:855981:863082:1 gene:ENSPFOG00000018085 transcript:ENSPFOT00000018211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWKSEVKVECCAVNDSESGSLLSNGELLVMCEDCKGDGELPDKCAEDGRDMMGAPVEVL
DEETSSPPAMASAPLLGRSVCANCNEEIVDKYLLKVNDLCWHVRCLSCSVCQTSLGSHAS
CYIKEKEVFCKLDYFRRYGTWCACCGRNIHSTDWVRRAKGNVYHLACFACFSCKRQLSTG
EEFALVEGKVLCRVHYDCMLDNLKRAVEKGNSVNMEGAVPTEQEINQPKPSKRARTSFTA
DQLQVMQAQFAQDNNPDAQTLQKLAEQTGLSRRVIQVWFQNCRARHKKHVSPNHTSSTPM
ASLQTGRLPQPTPTPEELQYTAYGGPEGSMLSALHSFIDIHSPPSMFQPLLPAHAMTSLP
VSHA
Download sequence
Identical sequences A0A087YJI6
XP_007558737.1.10163 XP_014855966.1.96476 XP_014914170.1.100837 ENSPFOP00000018189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]