SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018504 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018504
Domain Number 1 Region: 14-176
Classification Level Classification E-value
Superfamily RUN domain-like 1.1e-39
Family RUN domain 0.0006
Further Details:      
 
Domain Number 2 Region: 1390-1504
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.03e-26
Family Supernatant protein factor (SPF), C-terminal domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1197-1262
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.16e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 442-629
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000719
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018504   Gene: ENSPFOG00000018387   Transcript: ENSPFOT00000018526
Sequence length 1506
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519708.1:1104696:1122019:-1 gene:ENSPFOG00000018387 transcript:ENSPFOT00000018526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RATGGAMAVGESQLQRIIRDLHDAVAELEKEYKESGEPITDDSVSLHKFSYKLEYLLQFD
QKEKTTFLGTKKDYWDYFNDCLAKTKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQR
LGDTLQQCLMNQRVTSDWYYARSPFLKPQLSSDIINHLYELNEVQFDVASRGHDLDASWP
TFARRTVGSANSPGHMWKPPSRSSSINSLASSYSQQVLECASSPDYGHSLLNDLNDLLPA
CMEDSNTVENLRLELDQSELKQRNLLDKVQQLGEESGELKGVIEELQRQLDVSLAAQEGH
RGLQEELRVLQGRDVVLTRQVEALRAEEKAKETQLVSLQEKLAATEQKNMELMAKLDGFL
DEKGQQAASHFDSALKIHELLDKLKEAEKVKMEAEGKMVENRRQVERLEEEVRVNEMKSK
ENETKFEALLTSSSEEKAKLNAKVEEQFSTLEKLQLNLALREKEASSLQRQLQDVQQSLE
EKERELEEVKRGAKQEMEAMQKNIDDLKECLEGKVAEITVQLTNREAELSSSSETLQKLE
SKNQILTTERDELTTSLDQHKAKLNEQAAKIEDYQTQCASLQELKEKLQATVSRNEEQQN
EMTEHRAALEAELAALRASEKQLRGQMDDAKMTVDEKEKVLREENRSLDESLQRATMAAK
QSEVTSKRLEQENQTLREELDDLKATLSRTETELKNARIHIEELEASNTKLVSLQEQLSA
KEEQLENKEKEVVKLMSTLRELEAKEKENEMAKANAEATCAKQAELIERVTSEKRAIETL
QLERSSVQAKENQEVTAQLTVVEGQLDISMKEVSRLQGEILDLKVQVQRSEEEKLKSHAQ
LEVTEAQRDELRSLTEQLKSQVEALNQKHVAELLECKKKEETLVQQRNREAAAHAELAVS
SSAVREELAALKAENNKLALENTEIREGLHRANTEMAELGMSICKLNAEREEASEHLAGD
AAKIEELEKEVERIEECMNALRQENNSLREELTQKESLPRAITELQEELEKAKNQVNSVK
ECYQEEMDAVKFQMSSETMSHQAQIKAATENLEKVSAQLEEEQKNVSSLEAEVSELKAAN
EKYLQLIGEKDAYITQVEATIRENEGKIQQLGSSTASIEEAHLSMQTLCEELKQKLEATE
AEKQSQYLTMSAEIEDLNSTKINLEERLIELIKDKDALWQKSDALEFEQKLRAEERWWLV
DKEATHCLGCNEQFTWWVRRHHCRVCGRIFCYGCSNNFVLTKHSGKKERCCSDCYVQHNA
VEEKFIEPEMSSSARAGPQPPPEPAPPKSPSSAAVSSTGIKSDDGGYDIITEEEVNGVYD
SDSNSQTTGGSLEGEQDRQQPGARETGPGEVAPDDDSVPPVQDSEINLLRSGDVTLAVPL
SVEDISQFGDGSRELFIKSSCYSTINITVADCETTIGWMFSSEPKSISLGVVYRESSDSE
VEQAKVLIPLTRCNSHKETIQGQVKARHPGLYTLIFDNSFSRFISKKVFYHLTMEKPVIY
DGSDGP
Download sequence
Identical sequences ENSPFOP00000018504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]