SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018548 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018548
Domain Number 1 Region: 173-239
Classification Level Classification E-value
Superfamily Homeodomain-like 4.06e-19
Family Homeodomain 0.0028
Further Details:      
 
Domain Number 2 Region: 52-116
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000341
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 22-51
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000872
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018548   Gene: ENSPFOG00000018450   Transcript: ENSPFOT00000018570
Sequence length 363
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519708.1:1233393:1245560:1 gene:ENSPFOG00000018450 transcript:ENSPFOT00000018570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFMSVKCLENGYPRYADLGMDQKAVCAGCHRPIRDRFLLRVSDGLWHEECVRCAACGDPL
RNSCFLRDRKLFCRRDYAHLFAVRCGGCAEAISPAELVMRAGAAAFHLRCFTCKVCSCRL
QTGDRCVLREGQLLCAREDYHQCLASPASSDTGKSDDEEEEELGRITQRRGGADNPETKR
PKRPRTILTTQQRRTFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLA
RRQQQQEQQHTQEQCELSTGEYRLPSCGSLGSEAKCMGPSFAHMGLTSLEQQDWDTDPFR
QGLTPPQMPGDHMHPYGFQGLYGEIDTESLCHVADNDCLSLAGSSPLTPIDCLYSMQDSY
FTS
Download sequence
Identical sequences A0A087YKJ5
ENSPFOP00000018548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]