SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019316 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019316
Domain Number 1 Region: 353-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-47
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 5-79
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000179
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Domain Number 3 Region: 142-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000183
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019316   Gene: ENSPFOG00000019203   Transcript: ENSPFOT00000019338
Sequence length 549
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519652.1:1214343:1217931:1 gene:ENSPFOG00000019203 transcript:ENSPFOT00000019338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTMGTVGEPLKCPVCQDFFTEPVTLQCGHDFCLTCIRAVWETDESTEGPFFCPECQIIL
PPDLTLDINTSLQEKVKDFTANQQAETDSTAESSPIIHCDHCIEKPCVAIRTCLTCDASL
CQAHAQLHQQRSALREHTLVDVTKDPLSLKCREHRDELKLFCMEEKIPVCCLCVLVGVHK
HHKASQLHDASADFRSMLVANMNELLKRRGEAEHAIKDLESLYTQTVKSAADFREKISDK
YSRIRVVLDADERLMMQIIDAEEAYMTDWLEAQRGIMETQIKEIDRLRASNKALLQETND
LQFLQQIRSQNLCDPLDFPPLQAVNRDLCDHEKLKTIERLVDDLSLALSQHFPRMWSYLS
SPALDPKTAHPKLEISPDKKQVYWRRHPVGDRPNPQPYDSQYSVLTQESFTNGQHYWEVI
VQGKPFWMIGVTAGLVTKKTSPAQSSSSLGVNSTSWCIYHGDGQYLACHDTQEKQLPVAK
RVRKLGILANIQKGELSFYDADAMTLLHAFCVQCTEPLYPMFNPCIDMNGVNRQPLTLFW
IKDPWNWEE
Download sequence
Identical sequences ENSPFOP00000019316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]