SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019371 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019371
Domain Number 1 Region: 194-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.7e-77
Family Mitochondrial carrier 0.0000582
Further Details:      
 
Domain Number 2 Region: 22-191
Classification Level Classification E-value
Superfamily EF-hand 1.28e-35
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019371   Gene: ENSPFOG00000019244   Transcript: ENSPFOT00000019393
Sequence length 476
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520029.1:538288:555277:1 gene:ENSPFOG00000019244 transcript:ENSPFOT00000019393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMYPAMRKLFFTDCRCAGDPPKTYEELFAKLDTNKDGKVDVSELKAGLAAMGIQTGKGAV
QKIISSADKNKDDALDFNEFAKYLKEHEKKLRLTFKSLDKNKDGKVDYLEIQQSFADLGL
EITKEDARKILQSIDSDGTMSLDWNEWREHFLLNPATSLQEIIRYWKHSTVLDIGDSLTI
PDEFTEEEKTTGLWWKQLISGAVAGAVSRTGTAPLDRMKVFMQVHASTSNKISLVGGFKQ
MLKEGGVTSLWRGNGINVLKIAPETAIKFMAYEQYKKLLASEPGKVQTHERFMAGSLAGA
TAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILQKEGVKAFYKGYIPNILGIIPYAGI
DLAVYESLKNFWLSKYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAQASLE
GAEQLPMGRMVQKILEKDGFFGLYRGILPNFMKVIPAVSISYVVYENMRSGLGIQK
Download sequence
Identical sequences ENSPFOP00000019371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]