SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019410 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019410
Domain Number 1 Region: 167-237
Classification Level Classification E-value
Superfamily Homeodomain-like 3.64e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.27e-16
Family LIM domain 0.0084
Further Details:      
 
Domain Number 3 Region: 3-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000171
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019410   Gene: ENSPFOG00000019290   Transcript: ENSPFOT00000019432
Sequence length 404
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519624.1:3028550:3032386:-1 gene:ENSPFOG00000019290 transcript:ENSPFOT00000019432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLHCADCEKPILDRFLLKVLDRPWHIKCVQCCECKCSLTEKCFSRDGRLYCKNDFFRRF
GTKCGGCSQGILPSDLVRRAKSKVFHLNCFTCMMCNKQLSTGEELYILDEFKFVCKEDYQ
NNNGKDTILLSVTTCSDPSLSPDSQDPQDDGKDSEGGHASDKEACGNDNDEQSAVGKRRG
PRTTIKAKQLETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQNRRSKERRMKQLS
ALSARRHVFFRSPRRMRSLGERLEPGELGHFSYYGDYPSEYYGPGGNYEYFQGPPSSQAQ
TPADLGFVPSTVPAGTPLGAMDHHQHAGVGQHHCGADVQCFSDGASHHPADSPSPEPSGP
GSIHSISSEMCGPGTPFTAVSLSDNGYTNQLSQPSSELSEGTAW
Download sequence
Identical sequences A0A087YN07
ENSPFOP00000019410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]