SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019719 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019719
Domain Number 1 Region: 726-958
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-68
Family Nuclear receptor ligand-binding domain 0.0000000325
Further Details:      
 
Domain Number 2 Region: 38-406
Classification Level Classification E-value
Superfamily AF1104-like 1.83e-45
Family AF1104-like 0.01
Further Details:      
 
Domain Number 3 Region: 595-675
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-28
Family Nuclear receptor 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019719   Gene: ENSPFOG00000019595   Transcript: ENSPFOT00000019742
Sequence length 967
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519611.1:5917619:5936056:-1 gene:ENSPFOG00000019595 transcript:ENSPFOT00000019742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFAYLTIRDRMPTILTKAIDTIHRNKNKFFEEHEKEGISAEKQAISLLSKLRNELQTDKP
LLELMDGLSDTESWNQYMQRQQRQLGDQELVSWFKSPWLYVECYMYRRIQEAIWLNPPIN
NFDVFNEGKTQSFFESQQAVMALCTYLGDVQKSMEKLSENQLSEHFNKLLQVSLWGNKCD
LSISAGQENSQKASPIDSLPSLQSFILVNDSNMVWLTLTSSRRPEGSGQKTADRVDIVLD
NAGFELVTDLVLADFLVSSGLVRHIHFHGKCFPWFVSDVTANDFQWTIRQTMAANHKWMS
KSGYQWQSYLNEGIWSYHDHPFWTQPHEFCDMAADAPDLYATLQEANLVLFKGDLNYRKL
TGDRAWGHTVDFCTALRGFEPAPLCSLRTLKANVQVGLQPGQGEKLSTQDPSWMTNGKQN
PVQSKQEFGPALRPRISPASSELETLSSPRLPPSPRAPLSDMYPEESRGSGGVAAVDFLE
GTYDYATPTPAPTPLYSHSTTGYFSAPLDAQGPPSDGSLHSLGSGPTSPLVFVPTSPRLS
PFMHPPSHHYLETASTPAYRYEIRSSHQPASREDQCDARDEACSVGELEMAKETRFCAVC
SDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDRNRRKSCQACRLRKCYEV
GMMKGGVRKDRGRVLQRDKRQTGVGHREKTGKGLEHKEAPHHDKRRRSSALGGARSSVTG
LPSDQVLLLLQSAEPPILCSRQKLSRPYTEVTMMTLLTSMADKELVHMIAWAKKLPGFLQ
LSLHDQVLLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRNEGDCVEGMAEIFDMLL
ATASRFRMLKLQPEEFVCLKAIILLNSGAFSFCTGTMEPLHDSAAVQSILDTITDALIHH
ISQSGYSAQQQARRQAQLLLLLSHIRHMSNKGMEHLYSMKCKNKVPLYDLLLEMLDAHHH
HPVKPPQ
Download sequence
Identical sequences ENSPFOP00000019719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]