SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019833 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019833
Domain Number 1 Region: 176-243
Classification Level Classification E-value
Superfamily Homeodomain-like 7.7e-21
Family Homeodomain 0.0035
Further Details:      
 
Domain Number 2 Region: 63-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000892
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 361-397
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000033
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Domain Number 4 Region: 31-60
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000183
Family LIM domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000019833
Domain Number - Region: 473-543
Classification Level Classification E-value
Superfamily Prefoldin 0.00523
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019833   Gene: ENSPFOG00000019707   Transcript: ENSPFOT00000019856
Sequence length 558
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519616.1:2151982:2222673:1 gene:ENSPFOG00000019707 transcript:ENSPFOT00000019856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREDIRSPPSTPSTPSVCSPTSTASSVPSTGKNVCASCGLEILDRYLLKVNNLIWHVRC
LECSVCRTSLRQHSSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHL
ACFACYSCKRQLSTGEEFGLVEEKVLCRIHYDTMVENLKRAAESGNGITLEGAVPTEQDS
QPKPAKRARTSFTAEQLQIMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARH
KKHTPQHSGAPQGHPQSRIPSSLPDELHYSPFGSPERARMVALHGYIDSELTIMASSISV
RSFSMNRPSFSSRSLMDTGRARSRASVSFAAASPLTRSASISQDLNGPMSLQLNGLHGNS
TNEKEAMQSLNSRLANYLDKVRSLERSNADLEMKIKQLMIERIPKGHDLDSMMAQAHAVE
QEVRKKTLENARLMLEIMGNRIGDVSVCGERLRCPEELEQVRSRIARDEVNVEVDSARGP
ELGTILSELRSQYEGIVKKNKEQAEQWYRKKLETVQNEVKESNEALRGAQGELTERQRFL
QTLEVELDSLHKQVRERE
Download sequence
Identical sequences ENSPFOP00000019833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]