SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019851 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019851
Domain Number 1 Region: 483-574
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 8.24e-40
Family Small-conductance potassium channel 0.00000379
Further Details:      
 
Domain Number 2 Region: 352-523
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-28
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019851   Gene: ENSPFOG00000019725   Transcript: ENSPFOT00000019874
Sequence length 663
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519616.1:2720246:2752902:1 gene:ENSPFOG00000019725 transcript:ENSPFOT00000019874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPFQLHNDFFPEQQQQLQHCKYQHYYCGPEQQQQRIGRQHDQCCTCNSCTTCDARKSL
VFRGTSPTTVGTLRTPSETSSRQGCQHSTACDFTPSSHGSSTRHHHPHHQHHHQNSYNEI
AMSSCRYNGGVMRPLSNLSSSRRNIHEFDSESQPLQPISAADASDTLVSKPENNSATLMP
YASGDGGAGCGHSTGKSGKKKNQNIGEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIE
TELSWGAYGKESLYSLALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYE
RIFFICLEILVCAIHPIPGNYTFTWTARLAYSYVPSKTDADVDIILSIPMFLRLYLIARV
MLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRAC
ERYHDNQDITSNFLGAMWLISITFLTIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAV
VAKKLELTKAEKHVHNFMMDTQLTKSVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQ
RKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKTQNIMYDMVSDLNERGEDMEKRIALLET
KLETLLTNLQALPGLISQVINQQHRDFLEVQLQPYDKHSPERSQSVSRRRSSSTAPPTSS
ESS
Download sequence
Identical sequences ENSPFOP00000019851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]