SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019875 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019875
Domain Number 1 Region: 620-773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-46
Family SPRY domain 0.000063
Further Details:      
 
Domain Number 2 Region: 330-406
Classification Level Classification E-value
Superfamily RING/U-box 1.81e-20
Family RING finger domain, C3HC4 0.0077
Further Details:      
 
Domain Number 3 Region: 3-77
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-20
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 4 Region: 86-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000397
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 5 Region: 415-475
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000397
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019875   Gene: ENSPFOG00000019749   Transcript: ENSPFOT00000019898
Sequence length 773
Comment pep:novel scaffold:PoeFor_5.1.2:KI519616.1:3051930:3060463:1 gene:ENSPFOG00000019749 transcript:ENSPFOT00000019898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RISRDLTCSICLDLFKQPVSLPCDHTFCQGCIEGYWTGPRGPGQGGTGSCPQCRKVYPGK
SYRPNRIVANIVESYCHDAGCAERAPAPVPHCSRHREELKLYCEEDQELVCLVCGVSQEH
RNHTMMCVQEAEQKYRGFLNSSMDSLKVELNTALQCDREAEDEVKKLKDHTADLKQRIEA
QFSDLHQFLYQEEKLLQVKLKTEERRELIRLDEHKALLCVEISRLQRAVHEIEDKLKEQD
PFILLRVRICFYMRWTKVSFLPKHTLLRIILNASDIPDLIEQSLRFIASKPFPRGEFYWD
KPASGMLKAAMEKLRPSPIAGQVAKSSANRISRDLTCSICLDLFKQPVSLPCDHTFCQGC
IEGYWTGPRGPGQGGTGSCPQCRKVYPGKSYRPNRIVANIVESYCHDAGCAERAPAPVPH
CSRHREELKLYCEEDQELVCLVCGVSQEHRNHTMMCVQEAEQKYRGFLNSSMDSLKVELN
TALQCDREAEDEVKKLKDHTADLKQRIEAQFSDLHQFLYQEEKLLQVKLKTEERRELIRL
DEHKALLCVEISRLQRAVHEIEDKLKEQDPFILLRVSSASIKALPQRPSLKFEKPTFTPP
SLCEGRFAGPLQYRVWKSMRGSLYPVPAAITFNSSTANPWLSLSSSLTCVRYQTFNHTVE
DNPNRFNAALSLLASQGFTHGRHYWEIEVYSSTVWTVGVARESVPRKGVIKALPANGFWT
LTLSYGVRYMAGTSPPTVLSLEEPLARIGVYLDYKRGLVSFYNAESMTHLYTF
Download sequence
Identical sequences ENSPFOP00000019875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]