SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020097 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020097
Domain Number 1 Region: 381-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-47
Family SPRY domain 0.0005
Further Details:      
 
Domain Number 2 Region: 13-82
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000398
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 148-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000595
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020097
Domain Number - Region: 180-312
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00408
Family FCH domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020097   Gene: ENSPFOG00000019970   Transcript: ENSPFOT00000020120
Sequence length 566
Comment pep:novel scaffold:PoeFor_5.1.2:KI519655.1:176324:178021:-1 gene:ENSPFOG00000019970 transcript:ENSPFOT00000020120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKRTQRAQIDEEDVYCEICFDLLKYPVTIPCGHNFCINCIKAHWDEEEETGTNSCPQC
WKTFNPSGASEKTTALPSLVEQLKKISLQAAPDDSCYAGLQDVACFFCCGRKLKAISFCF
ICQAFYCSRHVHPHFDDPPLKKHKMVKASKMVQNNICSRHDEVIDVFCRTDQKFICSLCL
EKVHQGHDTVSAAAERAERQRELEERRGNIQQRIQDREKDVKLLQQEVEAINHSADKTVE
DSEKIFTELIRLLQKRSSDVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLS
HTEDHNQFLLNYPSLPALSESTHSSSINIRPLRHFEDVTAAVSELREKLQDVLRDSWTNI
SLKITKVDVFQSEPEPEPTTRAEFLRYSREITLDPNTAHSDLVLSEGNRKVTKTYRSQSY
PSHPDRFTECKQVLSKESLTGRCYWEVEWTDKYATIAVAYKNIRRVGSGHQCIFGNNDRS
WALDCSQGRYTGYTYDFRHNNKETSISGPGSSTIGVYLDHRAGVLSFYSISETMTLLHRV
QTTFTKPLLAGIRMHMYDDTAEFCQL
Download sequence
Identical sequences ENSPFOP00000020097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]