SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020220 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020220
Domain Number 1 Region: 379-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-46
Family SPRY domain 0.00066
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020220
Domain Number - Region: 114-309
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000366
Family FCH domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020220   Gene: ENSPFOG00000020093   Transcript: ENSPFOT00000020244
Sequence length 554
Comment pep:novel scaffold:PoeFor_5.1.2:KI519739.1:177032:178693:-1 gene:ENSPFOG00000020093 transcript:ENSPFOT00000020244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQQAVQLDRETFSCSICLDLLKDPVTTSCGHSYCLTCIKDHWDQEDQKRIHSCPQCRET
FIPRPVLKKNTMLAALVEQLKKTGLQAAPADYCYAGPEDVACDSCTGRKLKAIKSCLVCL
ASFCEKHLQPHYDSAAFKKHKLVEPSKNLQENICSKHDRLLEIFCRTDQKCICYLCSVDE
HKGHDTVSAAAERTERQRELEERRGNIQQRIQDQEKDVKLLQQEVEAINRSADKTVEDSE
KIFTQLIRLLQKRSSEVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTE
DHNQFLLNYPSLPALSESTHSSSINIRPLRHFEDVTAAVSELRDKLQDVLRDSWTNISLM
VTEVDVLLSEPEPKSRAGFLRYSCEITLDPNTAFTWLVLSEGNRKVTRMNQDQFYSSHPD
RFTGWFQVLSRESLTGRCYWEVERRGTVNISVAYKSISRAGGGYECGFGYNDKSWSLDCS
QISSGFRHNTIWTSILGPVSSRVGVYLDHTAGILSFYSVSETMTLLHRVQTRFTEPILAG
VCVCSGSSAEFCKP
Download sequence
Identical sequences ENSPFOP00000020220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]