SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020242 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020242
Domain Number 1 Region: 378-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-50
Family SPRY domain 0.00038
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-22
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 142-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-16
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020242   Gene: ENSPFOG00000020116   Transcript: ENSPFOT00000020266
Sequence length 555
Comment pep:novel scaffold:PoeFor_5.1.2:KI519971.1:391822:393486:-1 gene:ENSPFOG00000020116 transcript:ENSPFOT00000020266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQQAVQLDRDTFSCPICLDLLKDPVTTSCGHSYCMSCIKSFWDGENYKRIHSCPQCRKT
FTPRPLLQKNTILAALVEQLKKTRLQAAPADHCYAGPEDVACDFCTGRKLKAIKSCLVCL
TSYCEKHLQPHYDSATFKKHKLVEPSKNLQEKICSQHDEVMKMFCRTDQKCICVFCLLDE
HKGHDTVSAAAERTDRQRELEERRGSIHQGIQDREKDVKLLQQEVEAINHSADEAVEDSE
KIFTELIRLLQKRSSEVKHHIRSQQEDEVSRVKDVQEKLEQEITELKRKDAELEQLSHTE
DHNQFLLNYPSLPPREPKGSSSINIRPLRHFEDVTAAVSELRDKLQDVLRDSWTNTSLMV
TEVDNLFSEPEPKSRAGLIKYSCEITLDPNTANTRLVLSEGNRKVTAMGQPQSYSSHPGR
FTNHPQVVSRESLTGRCYWEVEWSGQQVYVAVVYKSMSRAGDGDECLFGGNDKSWALYCS
QSSMEFGHNNIWTSVSGPVSSRVGVFLDHGAGLLSFYSVSKTMTLLHRVQTRFTQPLHAG
VWLHNTACSAEFCKP
Download sequence
Identical sequences ENSPFOP00000020242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]