SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020243 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020243
Domain Number 1 Region: 377-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-49
Family SPRY domain 0.00053
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 140-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.8e-16
Family B-box zinc-binding domain 0.00071
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020243
Domain Number - Region: 209-280
Classification Level Classification E-value
Superfamily BAG domain 0.0589
Family BAG domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020243   Gene: ENSPFOG00000020117   Transcript: ENSPFOT00000020267
Sequence length 553
Comment pep:novel scaffold:PoeFor_5.1.2:KI519728.1:1718990:1720648:-1 gene:ENSPFOG00000020117 transcript:ENSPFOT00000020267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQNQLDKETFSCSICLDLLKDPVTTSCGHSYCMKCIKTHWDEEDQKGIHSCPHCSETFT
PRPVLKKNTMLAALVEQMKKTGLQAAAADHCYAGPEDVACDFCTGRKLKAIKSCLFCLAS
YCENHLQPHYFVAPLKKHKLVEPNKNLQENICSRHDEVIKIFCRTDQKCICSLCLIDEHK
GHDSVSAATERTEKQKELEERRGNIHQGIQDREEDVKLLQQEVEAINHSADKTVEDSEKI
FTELIRLLQKRSSEVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTDDH
NQFLLNFPSLPALSESTHSSSINIRPLRHFEDVTTAVSELRDKLQDVLRDSWTNISLMVT
EVDVLLSEPEPKSKAGFLKYSCEITLDPNTVNAWLGLSEGNRKVTRMNQYQSYSSHPDRF
TGCVQVLSRESLTGRCYWEVEWSGNQVNVAVAYKNISRAGDGNESGFGCNDKSWALVCQQ
NSFGYRHNNIWTSISGPGSSRVGVFLNHTAGLLSFYSVSETMTLLHRVQTTFTQPLLAGV
WVGTGDFAEFCKL
Download sequence
Identical sequences ENSPFOP00000020243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]