SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020325 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020325
Domain Number 1 Region: 351-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-63
Family SPRY domain 0.00000597
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 7.9e-21
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number 3 Region: 137-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000733
Family B-box zinc-binding domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020325   Gene: ENSPFOG00000020199   Transcript: ENSPFOT00000020349
Sequence length 536
Comment pep:novel scaffold:PoeFor_5.1.2:KI519887.1:163429:165036:1 gene:ENSPFOG00000020199 transcript:ENSPFOT00000020349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASSFLSEEQFLCSICLDVFTDPVTIPCGHNFCKTCITKHWNISRHQQCPLCKEQFDL
RPALRINTFISEMASHFRNARSLSGQVSPGSGGVLCDVCTKPKQKAFKSCLVCATAYCHT
HLEPHTRIAVLKKHKLINPVIKLETMMCGKHEKPLELFCKTDQRCVCPSCAASDHKKHRV
VALTEECKEKKKELEKTRVCVEQMIQERLLKMEQFKQLVKLSKQDAEEVTAAVVEDCSDL
IDSARKSLDHFIDVIVQKQKATEEQAEGFIKELEEEISMLMKNRSKLTQLLQIEDHFHLL
QNTPRMTVTAKDWTKVRVQSSCDTTVRMAAVQLETIRTEMKKLCARIELARVQLYGVDVT
LDPNTANPYLVISDDGKTVRCSDVTQVLPDKPERLSAFGVLGKQSFTSGRFYYEVEVKGK
TKWELGVVRESIDRKGENAICPENGYWAVWLRNGHYRALTGPSVPLVLVSEPQKVGVFVD
YDEGLVSFYDAESAHLIFSFTSCNFSEKLYPYFSPCPSDGGKNSAPLIISSISHTL
Download sequence
Identical sequences A0A087YQM2
ENSPFOP00000020325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]