SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020471 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020471
Domain Number 1 Region: 355-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-58
Family SPRY domain 0.00000903
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 1.55e-19
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 139-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000136
Family B-box zinc-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020471   Gene: ENSPFOG00000020345   Transcript: ENSPFOT00000020495
Sequence length 543
Comment pep:novel scaffold:PoeFor_5.1.2:KI520132.1:42780:44411:1 gene:ENSPFOG00000020345 transcript:ENSPFOT00000020495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASATSLVTDDNFSCSICLDVFTKPVSIPCGHTFCQDCITKHWETVSLFECPLCKETYLP
KPMLRVNIFIADMAERFKNAVRRKSSSPLQEALVGKVLCNLCTDPMSAAVKSCLVCFMSF
CKTHLQPHQTLPNLQRHKLIQPVNDLQNRLCKTHGEPFEFFCRGDQMFLCLSCKVKDHRT
HTVVTLEEEAKIRKTKLGKDKESTDQLIETRQQMSLDIRSSLDGVRKNAEQALSYKNHVM
AAVVDYIQRSQIELTEVINTKLQQIEKKGIDFTTELDAEILQIKEKKEQLDKTSLTDDDF
TFLENALSFTVSSPQVKNWADLKLNTAEFAIQDAMDELQRSVKSKINTLCDPTFREKQRY
AVDVTFDPDTAHPLLNISADGKQVATGYQKRNADNKPERFQKVLNVLAKEGFSSGKFYYE
VQVKGKPQWDLGVVSESINRKGDIRLSPKNGYWTIWFRNGNELTANAGPAVNLPVRQIPE
KVGVFVDYEEGQVSFYDVDARAIIFSFTGNSFTTKLFPFFSPCINEGGKNSAALIITPVT
TNH
Download sequence
Identical sequences A0A087YR18
XP_007540235.1.10163 ENSPFOP00000020471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]