SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020520 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020520
Domain Number 1 Region: 378-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-50
Family SPRY domain 0.00087
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-22
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 142-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000015
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020520
Domain Number - Region: 181-307
Classification Level Classification E-value
Superfamily t-snare proteins 0.0487
Family t-snare proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020520   Gene: ENSPFOG00000020394   Transcript: ENSPFOT00000020544
Sequence length 552
Comment pep:novel scaffold:PoeFor_5.1.2:KI519850.1:612296:613951:-1 gene:ENSPFOG00000020394 transcript:ENSPFOT00000020544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQAVHVDRETFSCPICLDLLKDPVTIPCGHSYCMSCIKSFWDENEEKKIYHCPQCRQT
FTPRPLLQKNTMLAALVEQLKKTGLQPAPADHCYAGPEDVACDFCTGRKLKAFRSCLVCL
VSYCRNHLQPHLDVAGLKKHKLVEPSKNLQKKICSQHDEVMKMFCRTDQKCICLICLMDE
HKDHDTVSTAAERTDRQRELEERRGSIHQGIQDREKDVKLLQQEVEAINHSADEAVEDSE
KIFTELIRLLQKRSSEVKHHIRSQQEDEVSRVKDVQEKLEQEITELKRKDAELEQLSHTE
DHNQFLLNYPSLPPREPKGSSSINIRPLSCDSAAATSLKSLGGKLQDVLRDTWTNISLMV
TEVDNLFSEPEPKSRAGLLKYSCEITLDPNTAHRNLLLSERNRKAQRMCQHQSYSQHPDR
FTGCYQVLSRERLTGRCYWEVEWSGQQVYVGVAYKNINKAGWGNECVFGHNANSWVLSCS
QSGFSYGHNNFWTSVSGPVSSRVGVFLDHGAGLLSFYSVSKTMTLLHRVQTRFTQLLHAG
VYVCGSVEFCKP
Download sequence
Identical sequences A0A087YR67
ENSPFOP00000020520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]