SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020554 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020554
Domain Number 1 Region: 23-399
Classification Level Classification E-value
Superfamily L domain-like 1.26e-63
Family Ngr ectodomain-like 0.053
Further Details:      
 
Domain Number 2 Region: 598-682
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000322
Family Fibronectin type III 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020554   Gene: ENSPFOG00000020428   Transcript: ENSPFOT00000020578
Sequence length 822
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519749.1:533502:535970:1 gene:ENSPFOG00000020428 transcript:ENSPFOT00000020578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSLVGICIFLLSLGGFSSSSPVSDFCPERCDCVHALHLVCANRGLRAVPKAGARVSDDA
LILSLGGNFITNVSASDFARYCKLVRLNLQYNQIAAIHPKAFEKLSRLEELYLGHNLLTA
LPAGSLQSLHKLSTFYGNDNAIKKILPENFLNLDNLVKLRLDGNSLEVLQDSVFTSLANL
QYLHLEHNKLHHIHRNAFLKLTNLRFLNLAHNKLSALTNVLSFSHLRSLTVLLLSENEIR
HIGNHVFQNLKKLSKLSLSNNRISRVDRGAVRGLSSLREFLIDGNELEEINAGWLDPLER
VEVLDFSHNRLVNVDPSAFSRLKHLKLLRLKNNFLTSLSGEIFAFNAVLQNIDLHGNNWT
CDCRLEDLKRWMTAAQSQRKLLTVFVQCHYPETLRGKYLDYVNSSQLHPLGNWNHSCQSG
SGPEDSRGRGVRKKLDGKDGTKLDREGKGEENWMELGDRNKTELGEREGLRQLNRGGTVM
RREWEKRKRGGQEEVEIQGDQGGLEAAEPSILKGKKTKKESRPATEAAGRRTKGSHRSNV
IPKIGPLVTSRPSHPTNTWLSTSEPVQPGEKFDLLRSDRDEAPPIISDPCVFNRHFITNV
SVDQVTSSTVTVYWTSRDHHRYSPGPRPGLHEVHYRILFDRFGNPDRFPRYVYAGRDSRS
VTLRELTSGVTYVVCVEGVVGGFVCHVAPRDHCAGLVTLPEAATRQGSTSLTSDLQLVTV
VTLVGNALLLLVISGIWLGRSLRKRLQKRKSAVHVRHMYSTRRPFRPTVAATSVSTDFTS
YQSSRSARLAPLEEGDLIEFPCDRFLDSCGVRRDSNMQRFSD
Download sequence
Identical sequences ENSPFOP00000020554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]