SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020704 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020704
Domain Number 1 Region: 373-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-50
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 140-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.16e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020704
Domain Number - Region: 184-299
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00858
Family FCH domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020704   Gene: ENSPFOG00000020578   Transcript: ENSPFOT00000020728
Sequence length 546
Comment pep:novel scaffold:PoeFor_5.1.2:KI520658.1:10430:12067:-1 gene:ENSPFOG00000020578 transcript:ENSPFOT00000020728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRHVQMDNVSCSICLDLLKDPVTIPCGHSYCMNCIKDHWDGDQRRKSSCPQCREKFKR
RPVLKKNIMLAALVEDLKKTGLQAAAADHCYAGPEDVACDVCTGRKRKAVKSCLFCLISY
CENHLQPHHDAPPLKKHKLVNPSNNLQDNICPHHEEVMKIFCRTDQQFICYLCLMDEHKD
HETVPAESEVTEKQKELQESRQQIHQRILDQEKDVKLLQQEVEAINVSADKAVEDSEEIF
TELIHLLRKRRSDVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTEDHT
QFLLNYPSLPALRESTHSSMINIRPLRHFEDVTAAVSELRDKLQDVLRDTWTNVELKITN
VDVLLSEPEPKTRAEFLKYSQEITLDPNTANRFLLLSEDNRKVMRVEEQQSYPDHPDRFT
VSFQVLSTESLTGRCYWEVEMGGRGFVAVSYKNISKKESFGFNDVSWSLFYTKDGCIRCH
NKVKTQVPGPVSSRIGVYLDHRAGILSFYSVSETMTLIYRVQTRFTQPLHAGVWLYDKSS
AEFIKP
Download sequence
Identical sequences ENSPFOP00000020704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]