SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020762 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020762
Domain Number 1 Region: 376-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-47
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 11-81
Classification Level Classification E-value
Superfamily RING/U-box 1.7e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000733
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020762   Gene: ENSPFOG00000020638   Transcript: ENSPFOT00000020788
Sequence length 556
Comment pep:novel scaffold:PoeFor_5.1.2:KI520484.1:18729:20396:-1 gene:ENSPFOG00000020638 transcript:ENSPFOT00000020788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSGFTLNREKLSCSICLDPLKNPVTIPCGHSYCMECLKNHWDREERKTYSCPQCRQTF
TPRPVLVRNTVLADLVDDMKKVGLQATPADHCYAGPEDVACDFCTDRKLKAFRSCLQCLV
SYCEQHLKPHWDFPALKKHKLINPSKKLQENICSKHGELKAIFCRTDQQCICYLCSLDDH
KDHSTISAAAERTERQKQLTPSRQKMKQQLQDCEKDVKLLQEELVAISRSADKALTDSEK
TFTELIRLIESTKSLIKQQIENQQKTEENRVKKLLEKLDKEITELRGKDAELERLSQTED
HIEFLHMFPSLSGPEERAETSLPKQRTRRYFQDVTEMISEVGNKLQSFLSQDWPRVSRAV
ANPDVLLPLEELTVRAEFLKFSQPITLDPNTVNMQLVLSERNRRATYRSIKQMYPAHSER
FQNRSQVLSRETLTRRHYWEVEWSGNGAFIGVAYKTISRTGDNSEFGKTDKSWVLLCSES
LREFRHNNSITQILGPQSKRIGVYLDHRAGLLSFYSISEAMSLLHRVQTTFTQPLCAAFR
AYHGLASQSTAVFCEI
Download sequence
Identical sequences ENSPFOP00000020762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]