SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020780 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020780
Domain Number 1 Region: 384-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-30
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily RING/U-box 5.74e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-16
Family B-box zinc-binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020780   Gene: ENSPFOG00000020656   Transcript: ENSPFOT00000020806
Sequence length 554
Comment pep:novel scaffold:PoeFor_5.1.2:KI520842.1:1737:3791:1 gene:ENSPFOG00000020656 transcript:ENSPFOT00000020806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQQAVQLDRETFSCSICLDLLKDPVTIPCGHSYCMDCIKAHWDEEDQKRVHSCPQCRKT
FTQRPVLQKNTMLAALAEQLKKTGLQVAPADHCYAGPEDVACDVCSGRKLKAIKSCLACP
ASYCEKHLQPHYEVAPLKKHKLVEPTKNLQENICSQHDEVMKMYCRKDRKCICYLCPVDY
HKGHDTVSAAAERTERQKELDERRGKIQQMIKDKDKDVKLLQQETEDINVSADKTVKESE
KIFTELIRLLRKRSSEVKQQIRSKQETEVSRVKDVQEKLEQEIRELKRKDAELEQLSNIE
DHIQFLLNYPSLPALRETEHTSIINIRPLRHFEDVTAAVSELSEKLQDILKDPWTNIELS
FTEVDVLLSEPGPKSRAGFLKYSCEIILDSNKADTQLTRTNQRQSNSGYYINQSYSSGSG
SFTGCYQFLSRESLPERCYWEVKWEGQQVYVAVAYKNTRREENEYDRSWALVCSSSYENN
YFKFVHDKFQTYISGPHSSRVGVYLDHRAGILSFYRVSETMTLLHRVQTKFTEPLHAGVW
VSKAEDFAVFYKPQ
Download sequence
Identical sequences A0A087YRX7
ENSPFOP00000020780 XP_007544578.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]