SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020792 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020792
Domain Number 1 Region: 378-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-43
Family SPRY domain 0.00091
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-19
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 143-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000153
Family B-box zinc-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020792   Gene: ENSPFOG00000020668   Transcript: ENSPFOT00000020818
Sequence length 554
Comment pep:novel scaffold:PoeFor_5.1.2:KI519921.1:684837:686498:1 gene:ENSPFOG00000020668 transcript:ENSPFOT00000020818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEMEQSHLDRETFSCFICMNLLKDPVAIPCGHSYCMKCIKTHWDAEDQKGIHSCPGCRET
FTPRPVLKKNIMLAALVEELKKIGLQAAAAADHCYAGPEDVACDVCSERKLKAIKSCLVC
LVSYCKERLQPHYDSAPFRKHKLVEPARDLQENICSRHNKVIDIFCRTDQKTICYLCSVD
EHKGHDTVSAASERAERQTELEEGRGNVHQMIQDKENDVKLLQQEVEAINHSADKTVEEN
DKVFTQLIHLLQRRSSEVKQQIRFHQKTEVSRVKDLQKKLEQEITELKRKDAELEQLSHT
EDHSQFLLNYSSLPALSESTHSSSIKVRPLRHFEDMTAAVSELRQKLQDVLRDAGTNISL
MVTEVDVLLSEPEPKSRAEFLKYYREITLDPNTANKYLELSMGNRKVTEMNKDHFYSSHS
ERFTYWDQVLSRESLTGRCYWEVEWSGKVCLAVTYKNISRIGEGNKCGFGCNNKSWALDC
NKSKFGHSNIWTSVSGPVSSRVGVYLNHTAGLLSFYSVSDIMTLIHRAQTTFTQLLLAGV
WVWYQGTSAEFCKP
Download sequence
Identical sequences ENSPFOP00000020792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]