SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020799 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020799
Domain Number 1 Region: 344-528
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-63
Family SPRY domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 2.36e-20
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 133-195
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.82e-17
Family B-box zinc-binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020799   Gene: ENSPFOG00000020675   Transcript: ENSPFOT00000020825
Sequence length 529
Comment pep:novel scaffold:PoeFor_5.1.2:KI519666.1:2050410:2051999:1 gene:ENSPFOG00000020675 transcript:ENSPFOT00000020825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGSSLQSEDRFLCPICLDVFTDPVSTPCGHNFCKACIIQHWDINVICKCPMCKERFTS
RPQLRVNTFIKETVAQFRREAQQEAAKPGEVPCDVCTGTKLKALKSCLVCLTSYCQPHLE
PHLTAPRLKKHQLMEPVENLEDRICLQHDKPLELFCRTDQTCVCSLCPVLNHKNHEFAPL
REESERKKAELRKAEAAFQEMVQKRRLKIWEIRESVKIRKYAADREKVEGVQVFTALKES
AERGLKELLKEIEDKQETTEKQAEDFIRDLEQEISELMKRSSEVKQLSQSEDHLNLLQSI
SSLKAFPPTKAWTEVRVHPPSYEGTVMRAFAQVDVNMKKILKLKRVQQFAVDVTLDPDTA
NPNLILSVDRKQVKHGDVKKKLPDNPERFSYCVFVLGRQSFSSGRFYFEVQVKGKTHWYL
GVARESVDRKESITLSPEDGFWTVGLRNQNQYSARAEPPVHLHLHPGPEKVGVFVDYEEG
LVSFYDVDIPAQIFSYTGCDFKDKLYPFFSPELNHKGKNSAPLILCPVR
Download sequence
Identical sequences XP_007553449.1.10163 XP_014865234.1.96476 ENSPFOP00000020799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]