SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020863 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020863
Domain Number 1 Region: 383-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-46
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 139-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.33e-17
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 15-78
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000783
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020863
Domain Number - Region: 175-299
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0324
Family FCH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020863   Gene: ENSPFOG00000020739   Transcript: ENSPFOT00000020889
Sequence length 553
Comment pep:novel scaffold:PoeFor_5.1.2:KI520147.1:193404:195062:1 gene:ENSPFOG00000020739 transcript:ENSPFOT00000020889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQGGIQLDQGNFSCLDLLKDRVNIPCGHSYCMNCIKHHWEGEDQRRIPSCPQCRKEFKP
RPELEKSIMLAALVEDLKKTGLQAAPADHCYAGPEDVACDVCTGRKRKAVKSCLVCLVSY
CENHLQPHYDVPGLKKHKLVDPSKMLQENICSRHDEAMKIFCRTDQQCICYLCTMEEHKG
HETVPAAAERDEKKKELQLSRQQIHQRIQDQEKDVKLLQQEVEAINVFADKAVEDSEKIF
TELIRLLQERSSEVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTEDHT
QFLLNYPSLPALRESTHSSSINIRPLRHFEDVTAAVTELRDKLQDVLRDTWTKISLMVTD
VNVLLSEPEPKTRDGFLKFSQIITLDPNTLNRFLLLSEGKRKVTFVNHEQSYPDHPDRFD
GLCYQVLSTESLTECCYWEVEWRGGGAVAVSYKNISRTERLGSNDQSWSLYCDRNSYTFH
HNNIKTTLARPVSSRIGVYLDQTAGILCFYSVSETMTLLHRVQTRFTQPLHAAIRLCFSF
SCPDGSSAEFIKL
Download sequence
Identical sequences A0A087YS60
ENSPFOP00000020863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]