SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020933 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020933
Domain Number 1 Region: 376-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-50
Family SPRY domain 0.00049
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-20
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 3 Region: 144-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-16
Family B-box zinc-binding domain 0.00054
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000020933
Domain Number - Region: 185-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00178
Family FCH domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020933   Gene: ENSPFOG00000020810   Transcript: ENSPFOT00000020960
Sequence length 556
Comment pep:novel scaffold:PoeFor_5.1.2:KI519898.1:574597:576267:1 gene:ENSPFOG00000020810 transcript:ENSPFOT00000020960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQGSHMESAKYSCSICLDLLKDPVTIPCGHSYCMNCIKDHWDGDDERRIHSCPQCRET
FIPRPVLKKNIMLAELVEDLKKTGLQAAPADHCYAGPEDVACDVCTGRKMKAVKSCLVCL
VSYCENHVQPHYEVPTLQKHQLGDPSKKLQDNICPHHEEVMRIFCRTDQQCICYLCTMDE
HKGHETVPAAAERAEKQKKLQESRQQIHQRIQDQEEDVKLLQQEVEAINVSADKAVEDSE
EIFTELIRLLQERSSEVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTE
DHTQFLLNYPSLPALRESTHSSSINIRPLRHFEDVTAAVSEITYLMEDVLKDTWTNISLT
ITEVDVLLSEPEPKTRDGFLKYSQEITLDPNTANRFLLLSEANRKVTAMKEEQSYPDHPD
RFTDSFQVLSKESLTGRCYWEVEWREGGVNVAVSYQNIGRGGSNECLFGVNDKSWSFSCD
TDSYTFLHNNIETPVPGPVSSRIGVYLDHRAGILSFYSVSETMTLLHRVQTRFTQPLHAG
VGPFFNGDSTEFVKLK
Download sequence
Identical sequences A0A087YSD0
ENSPFOP00000020933 XP_007571890.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]