SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000021054 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000021054
Domain Number 1 Region: 355-540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-68
Family SPRY domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 7.29e-21
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 138-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.16e-17
Family B-box zinc-binding domain 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000021054
Domain Number - Region: 176-284
Classification Level Classification E-value
Superfamily Ferritin-like 0.0498
Family Ferritin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000021054   Gene: ENSPFOG00000020932   Transcript: ENSPFOT00000021082
Sequence length 553
Comment pep:novel scaffold:PoeFor_5.1.2:KI519830.1:749815:751476:-1 gene:ENSPFOG00000020932 transcript:ENSPFOT00000021082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGSNLQSKDQFLCSICLDVFTDPVTTACGHNFCKTCITQHWDGNVPYKCPLCNEYFAS
RPQLRVNTLFSEMIDQLRREASSSSSEEQVAKKGEVPCDVCTGPKLKALKSCMVCLASYC
QTHLEPHLTAPRLKKHQLMEPVENLEDRMCLQHDKPLELFCRTDQTCVCLLCPILNHKDH
EFVPLREESKENKAELRNMEAEVHEMIQERRLTIQEIRESVKISKDAADREKAEGVQVFT
ALMESAERGLKELLKEIQDKQEATEKQAEDFIRDLEQEISELKKRSSEVKQLSQSEDHLH
LLQSFSSLKAAPPTKTWTEVRVHPLSYEGTVVRSVAQVEQEIREKKLQKLTEAELKRVQR
FAVDVTLDPDTAQPWLILSGDGKQVNHGDVRKNLPDNPERFSLCPCVLGQQSFSSGRFYF
EVQVKGKTKWDLGVARESVTRKGNITLSPQNGFWTVVLRNGNKYKVFADPSVHLHLHPGP
EKVGVFVDYEEGLVSFYDVDAAALIYSFTGCRFTQKLYPYFSPCNNHGGTNSAPLLICPV
EQVDHCTDKDDAE
Download sequence
Identical sequences ENSPFOP00000021054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]