SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000021060 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000021060
Domain Number 1 Region: 379-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-46
Family SPRY domain 0.00079
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 1.66e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 140-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-17
Family B-box zinc-binding domain 0.00048
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000021060
Domain Number - Region: 123-309
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0356
Family FCH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000021060   Gene: ENSPFOG00000020938   Transcript: ENSPFOT00000021088
Sequence length 552
Comment pep:novel scaffold:PoeFor_5.1.2:KI520195.1:59774:61432:1 gene:ENSPFOG00000020938 transcript:ENSPFOT00000021088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQNQMDRETFSCSICLDLLKDPVTIPCGHSYCMNCIKSFWGEGEQKKSYHCPQCRHSFT
QKPFLQKSTMLAALVEQLQKTGLQAAPADLCSTGHEDVACDFCTERKLKAIKSCLVCLAS
YCEKHLQAHYDEPQLRNHRLVEPSKNLQENICSKHDEVMKLFCRTDQKCICYLCSVDEHK
GHDTVSAAAERAERQIELEERRGNIQQRIQDREKDVKLLQQEVEAINHSADKTVEDSEKI
FTELIRLLQKRSSDVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTEDH
NQFLLNYPSLPAPRESTHSSSINIRPLRHFEDVTAAVSELRDELQDVLRDSWTNISLMVS
EVGVLLSEPEPEPKSRAGFLNYLCKITLDSDTAHNKLILSEGNRKVTWMDQPQPCSNHPE
RFTVYHQVLSRESLTGRRYWEVEWRGTVYVAVTYKNISRAGHGNNCKFGGNDKSWALNCS
QDGYKFGHNNDWTSISGPVSSRVGVYLDHSIGELFFYRVSESMTLIHRVQTRFTQPLHAG
VLVVGSAEFCKS
Download sequence
Identical sequences ENSPFOP00000021060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]