SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspfo1|576372|CE352456_13994 from Aspergillus acidus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspfo1|576372|CE352456_13994
Domain Number 1 Region: 172-251
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000628
Family Coronavirus S2 glycoprotein 0.0081
Further Details:      
 
Weak hits

Sequence:  jgi|Aspfo1|576372|CE352456_13994
Domain Number - Region: 319-357,578-614
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0863
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspfo1|576372|CE352456_13994
Sequence length 739
Sequence
MLFSKSGRTIFPLLPPYGVQDPNGVQGRVIPVHPDGSTPYLGLRARLSQVWLNRWTVLLL
LVLARVLMAASSIKTDMNRAKSEALSACTSVESMGDAMVSMPHYLAGGVNELTADGVNAA
IDGLKTLLMLTLTGVEELVIFFVKVMYQTYLCLFTLVVHGVVDVGLSLIEDVTDVLNSTV
KTVAKDIAKVTETFEDDYNKVISKINGVASLFGGSVPTLNITSEIDKLENVQLPSSIDKD
LQKINDSIPNFNEVMNFTENVIRFPFDEVKKLVNESLGNYTFNASALPVPAKKTLTFCDK
NDGINSFFAGATDIILTARKIFIAVLVVAAIIACVPMAWQEIRRWHTMKERSQLVRKEAH
DPMDVVYIVSRPHTAALGIKAASRFSNSRRQILVRWVIAYATSPAALFVLLLALAGLLSC
LCQYILLSAVKRTVPELSNEVGDFAEEVVSVLQNTSAQWASDANKVIINVDDELNDHVFG
WVNTSTGALNDTLNTFVNKTIGVLNDTFGGTLLYEPLLDVFDCLIGLKVESVQKGLTWVS
DHAHIDFPLLPNDTFSRGAADSINSSDASDSFLADAGDETSNKITEVVYKVISALEKALL
IEVIIASCILLVWVINAMFGILRALTLFWGRDKNRGEGGPAPPHSRPNPGSGPDTNGFTD
VPLTTLPSHRDFEETAARSQPAPRYEVATSQGSSAAVLSSDSEYPDEKVGFAGQRNALRV
DGVSDLRGSSYVEYGMEKY
Download sequence
Identical sequences A0A1M3TL97
jgi|Aspfo1|576372|CE352456_13994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]