SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|75812290|ref|YP_319909.1| from Anabaena variabilis ATCC 29413

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|75812290|ref|YP_319909.1|
Domain Number 1 Region: 26-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.41e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.007
Further Details:      
 
Domain Number 2 Region: 492-546,580-607
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000157
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|75812290|ref|YP_319909.1|
Sequence length 845
Comment filamentous haemagglutinin-like [Anabaena variabilis ATCC 29413]
Sequence
MNSKFTILFTEISFLITIFTTFIPLCQAQINADNSSQNNSAVNVQGNTIFIEGGTQLGGN
LFHSFKDFSINYGDTAYFNNASIIQNIISRVTGNSISNINGTIRNNGQANLFILNPNGFF
FGNSARLNIGGSFLATTANNIKFSNNIDFSANRNQLDPLLKVSVPVGLVFIGNSGEIRLQ
GSGHNINRIANRNFDFITPIDASRFSGLQVQPGNNISLIGGNVSLEGGILSTRNGKLQIG
SVLDGYVGLEQQDNDIDFDFNNVNTFRNIILTKNSLLFINSNAGTGNTIDIQGKNINILD
GSLVFTQNHGFKTGAVKIDAQSLNIQGSSNLALSAIYTSNFGSTPGESIQLDVKDVTIQG
GQIATTTFTNAPSGLITINSNSLKISGDTPSYANPDGLGGINTFSYSSGKGGDIAGKINN
IIIGLDGVLNTVASGSGAGGNLFLELENLVIKDGGASLGSSTIRSGQGGNVFIKSQNIDI
SGQSALLRPSNITSSTFGYGNGGNIDINTLNLIISNGGGISSSTLSAGKAGNISINSSNS
INVVGTNLNSNSPSFINSSNFLLIDPNLQKLLYRQPPLLIGQAGNIFLNTNTINISNGGL
INARNEGVNDAGNIRISANTININSQGEVNATTTIGEGGNIILNSRNLFLNNSRITTTAG
GMGNGGNIRINTGILVGSNNNQIVANAFEGRGGNIQINGQGVFLSPNTQVNSKSQRGIDG
TVDINANVFLAQTPVKSQGFQESPQIVSTCQGRSNTKGNNEFIMTGTGGLPASSEQLPDV
ESTWQANSTENISYIEPTVDNEIIEVQGWVRNSDGSITLTAQANRVSANANQSASSCNYQ
PKPKV
Download sequence
Identical sequences A0A1W5CD28 Q3M2R6
240292.Ava_B0006 gi|75812290|ref|YP_319909.1| gi|75812290|ref|YP_319909.1|NC_007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]